![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
![]() | Protein automated matches [190590] (26 species) not a true protein |
![]() | Species Campylobacter jejuni [TaxId:197] [187859] (2 PDB entries) |
![]() | Domain d2ig3b_: 2ig3 B: [165539] automated match to d1ux8a_ complexed with act, cyn, hem, so4 |
PDB Entry: 2ig3 (more details), 2.15 Å
SCOPe Domain Sequences for d2ig3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ig3b_ a.1.1.0 (B:) automated matches {Campylobacter jejuni [TaxId: 197]} mkfetinqesiaklmeifyekvrkdkdlgpifnnaigtsdeewkehkakignfwagmllg egdyngqplkkhldlppfpqeffeiwlklfeeslnivyneemknvilqraqmiashfqnm lyky
Timeline for d2ig3b_: