| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
| Protein automated matches [190590] (26 species) not a true protein |
| Species Campylobacter jejuni [TaxId:197] [187859] (2 PDB entries) |
| Domain d2ig3a_: 2ig3 A: [165538] automated match to d1ux8a_ complexed with act, cyn, hem, so4 |
PDB Entry: 2ig3 (more details), 2.15 Å
SCOPe Domain Sequences for d2ig3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ig3a_ a.1.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}
mkfetinqesiaklmeifyekvrkdkdlgpifnnaigtsdeewkehkakignfwagmllg
egdyngqplkkhldlppfpqeffeiwlklfeeslnivyneemknvilqraqmiashfqnm
lykyggh
Timeline for d2ig3a_: