SCOPe 2.07: Domain d2ifca_: 2ifc A:

Lineage for d2ifca_ (2ifc A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (2 families)

5. Family a.103.1.1: Citrate synthase [48257] (2 proteins)
   duplication: large domain consists of two structural repeats
   the second repeat is interrupted by the small domain
   automatically mapped to Pfam PF00285

6. Protein automated matches [190675] (10 species)
   not a true protein

7. Species Thermoplasma acidophilum [TaxId:2303] [188213] (3 PDB entries)

8. Domain d2ifca_: 2ifc A: [165532]
   automated match to d1o7xc_
   complexed with oaa

Details for d2ifca_

PDB Entry: 2ifc, 1.7 Å

PDB Description: the structure of the binary complex of oxalateacetate with citrate synthase from the thermophilic archaeon thermolasma acidophilum

PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d2ifca_:

Sequence; same for both SEQRES and ATOM records:

>d2ifca_ a.103.1.1 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
eeiskgledvnikwtrlttidgnkgilryggysvediiasgaqdeeiqylflygnlpteq
elrkyketvqkgykipdfvinairqlpresdavamqmaavaamaasetkfkwnkdtdrdv
aaemigrmsaitvnvyrhimnmpaelpkpsdsyaesflnaafgrkatkeeidamntalil
ytdhevpasttaglvavstlsdmysgitaalaalkgplhggaaeaaiaqfdeikdpamve
kwfndniingkkrlmgfghrvyktydprakifkgiaeklsskkpevhkvyeiatkledfg
ikafgskgiypntdyfsgivymsigfplrnniytalfalsrvtgwqahfieyveeqqrli
rpravyvgpaerkyvpiaer

Timeline for d2ifca_:

• d2ifca_ first appeared in SCOPe 2.01
  
• d2ifca_ appears in SCOPe 2.06
  
• d2ifca_ appears in the current release, SCOPe 2.08