Lineage for d2ifca_ (2ifc A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2336030Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2336031Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2336032Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2336098Protein automated matches [190675] (10 species)
    not a true protein
  7. 2336128Species Thermoplasma acidophilum [TaxId:2303] [188213] (3 PDB entries)
  8. 2336129Domain d2ifca_: 2ifc A: [165532]
    automated match to d1o7xc_
    complexed with oaa

Details for d2ifca_

PDB Entry: 2ifc (more details), 1.7 Å

PDB Description: the structure of the binary complex of oxalateacetate with citrate synthase from the thermophilic archaeon thermolasma acidophilum
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d2ifca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ifca_ a.103.1.1 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
eeiskgledvnikwtrlttidgnkgilryggysvediiasgaqdeeiqylflygnlpteq
elrkyketvqkgykipdfvinairqlpresdavamqmaavaamaasetkfkwnkdtdrdv
aaemigrmsaitvnvyrhimnmpaelpkpsdsyaesflnaafgrkatkeeidamntalil
ytdhevpasttaglvavstlsdmysgitaalaalkgplhggaaeaaiaqfdeikdpamve
kwfndniingkkrlmgfghrvyktydprakifkgiaeklsskkpevhkvyeiatkledfg
ikafgskgiypntdyfsgivymsigfplrnniytalfalsrvtgwqahfieyveeqqrli
rpravyvgpaerkyvpiaer

SCOPe Domain Coordinates for d2ifca_:

Click to download the PDB-style file with coordinates for d2ifca_.
(The format of our PDB-style files is described here.)

Timeline for d2ifca_: