![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.103: Citrate synthase [48255] (1 superfamily) multihelical; consists of two all-alpha domains |
![]() | Superfamily a.103.1: Citrate synthase [48256] (2 families) ![]() |
![]() | Family a.103.1.1: Citrate synthase [48257] (2 proteins) duplication: large domain consists of two structural repeats the second repeat is interrupted by the small domain automatically mapped to Pfam PF00285 |
![]() | Protein automated matches [190675] (10 species) not a true protein |
![]() | Species Thermoplasma acidophilum [TaxId:2303] [188213] (3 PDB entries) |
![]() | Domain d2ifca_: 2ifc A: [165532] automated match to d1o7xc_ complexed with oaa |
PDB Entry: 2ifc (more details), 1.7 Å
SCOPe Domain Sequences for d2ifca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ifca_ a.103.1.1 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]} eeiskgledvnikwtrlttidgnkgilryggysvediiasgaqdeeiqylflygnlpteq elrkyketvqkgykipdfvinairqlpresdavamqmaavaamaasetkfkwnkdtdrdv aaemigrmsaitvnvyrhimnmpaelpkpsdsyaesflnaafgrkatkeeidamntalil ytdhevpasttaglvavstlsdmysgitaalaalkgplhggaaeaaiaqfdeikdpamve kwfndniingkkrlmgfghrvyktydprakifkgiaeklsskkpevhkvyeiatkledfg ikafgskgiypntdyfsgivymsigfplrnniytalfalsrvtgwqahfieyveeqqrli rpravyvgpaerkyvpiaer
Timeline for d2ifca_: