![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
![]() | Superfamily a.24.3: Cytochromes [47175] (3 families) ![]() Heme-containing proteins |
![]() | Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins) automatically mapped to Pfam PF01322 |
![]() | Protein Cytochrome c' [47180] (9 species) |
![]() | Species Alcaligenes sp. [TaxId:512] [47184] (13 PDB entries) |
![]() | Domain d1e83a_: 1e83 A: [16553] complexed with hec |
PDB Entry: 1e83 (more details), 2.05 Å
SCOPe Domain Sequences for d1e83a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e83a_ a.24.3.2 (A:) Cytochrome c' {Alcaligenes sp. [TaxId: 512]} efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach dayrkk
Timeline for d1e83a_: