SCOPe 2.08: Domain d2if0a_: 2if0 A:

Lineage for d2if0a_ (2if0 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (37 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186896] (13 PDB entries)

8. Domain d2if0a_: 2if0 A: [165529]
   automated match to d2f7sa1
   complexed with gdp, mg

Details for d2if0a_

PDB Entry: 2if0, 2.8 Å

PDB Description: Crystal Structure of mouse Rab27b bound to GDP in monoclinic space group

PDB Compounds: (A:) Ras-related protein Rab-27B

SCOPe Domain Sequences for d2if0a_:

Sequence, based on SEQRES records:

>d2if0a_ c.37.1.8 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvydtqgadgasgka
fkvhlqlwdtaglerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanaycen
pdivlignkadlpdqrevnerqarelaekygipyfetsaatgqnveksvetlldlimkrm
ekcv

Sequence, based on observed residues (ATOM records):

>d2if0a_ c.37.1.8 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ydylikllalgdsgvgkttflyrytdnkfnpkfittvgidfrekrvvydafkvhlqlwdt
aglerfrslttaffrdamgfllmfdltsqqsflnvrnwmsqlqanaycenpdivlignka
dlpdqrevnerqarelaekygipyfetsaatgqnveksvetlldlimkrmekcv

Timeline for d2if0a_:

• d2if0a_ first appeared in SCOPe 2.01
  
• d2if0a_ appears in SCOPe 2.07