Lineage for d2ie8a_ (2ie8 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1183841Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 1183842Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 1183843Family c.86.1.1: Phosphoglycerate kinase [53749] (2 proteins)
    Domain 2 binds ATP
  6. 1183875Protein automated matches [190709] (4 species)
    not a true protein
  7. 1183906Species Thermus caldophilus [TaxId:272] [187856] (1 PDB entry)
  8. 1183907Domain d2ie8a_: 2ie8 A: [165528]
    automated match to d1v6sa_

Details for d2ie8a_

PDB Entry: 2ie8 (more details), 1.8 Å

PDB Description: Crystal structure of Thermus caldophilus phosphoglycerate kinase in the open conformation
PDB Compounds: (A:) phosphoglycerate kinase

SCOPe Domain Sequences for d2ie8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ie8a_ c.86.1.1 (A:) automated matches {Thermus caldophilus [TaxId: 272]}
yatlldldpkgkrvlvrvdynvpvqdgkvqdetrileslptlrhllaggaslvllshlgr
pkgpdpryslapvgealrahlpearfapfppgseearreaealrpgevlllenvrfepge
ekndpelsaryarlgeafvldafgsahrahasvvgvarllpayagflmekevralsrllk
dperpyavvlggakvsdkigviesllpridrlliggamaftflkalggevgrslveedrl
dlakdllgraealgvrvylpedvvaaerieagvetrvfparaipvpymgldigpktreaf
aralegartvfwngpmgvfevppfdegtlavgqaiaalegaftvvgggdsvaavnrlglk
erfghvstgggasleflekgtlpglevleg

SCOPe Domain Coordinates for d2ie8a_:

Click to download the PDB-style file with coordinates for d2ie8a_.
(The format of our PDB-style files is described here.)

Timeline for d2ie8a_: