Lineage for d2ie8a1 (2ie8 A:3-390)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910394Fold c.86: Phosphoglycerate kinase [53747] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has parallel beta-sheet of 6 strands, order 342156
    Domain 2 has parallel beta-sheet of 6 strands, order 321456
  4. 2910395Superfamily c.86.1: Phosphoglycerate kinase [53748] (2 families) (S)
  5. 2910396Family c.86.1.1: Phosphoglycerate kinase [53749] (2 proteins)
    Domain 2 binds ATP
    automatically mapped to Pfam PF00162
  6. 2910433Protein automated matches [190709] (5 species)
    not a true protein
  7. 2910479Species Thermus caldophilus [TaxId:272] [187856] (1 PDB entry)
  8. 2910480Domain d2ie8a1: 2ie8 A:3-390 [165528]
    Other proteins in same PDB: d2ie8a2
    automated match to d1v6sa_

Details for d2ie8a1

PDB Entry: 2ie8 (more details), 1.8 Å

PDB Description: Crystal structure of Thermus caldophilus phosphoglycerate kinase in the open conformation
PDB Compounds: (A:) phosphoglycerate kinase

SCOPe Domain Sequences for d2ie8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ie8a1 c.86.1.1 (A:3-390) automated matches {Thermus caldophilus [TaxId: 272]}
tlldldpkgkrvlvrvdynvpvqdgkvqdetrileslptlrhllaggaslvllshlgrpk
gpdpryslapvgealrahlpearfapfppgseearreaealrpgevlllenvrfepgeek
ndpelsaryarlgeafvldafgsahrahasvvgvarllpayagflmekevralsrllkdp
erpyavvlggakvsdkigviesllpridrlliggamaftflkalggevgrslveedrldl
akdllgraealgvrvylpedvvaaerieagvetrvfparaipvpymgldigpktreafar
alegartvfwngpmgvfevppfdegtlavgqaiaalegaftvvgggdsvaavnrlglker
fghvstgggasleflekgtlpglevleg

SCOPe Domain Coordinates for d2ie8a1:

Click to download the PDB-style file with coordinates for d2ie8a1.
(The format of our PDB-style files is described here.)

Timeline for d2ie8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ie8a2