SCOPe 2.04: Domain d2ie2f_: 2ie2 F:

Lineage for d2ie2f_ (2ie2 F:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (18 species)
   not a true protein

7. Species Echinophyllia sp. [TaxId:301887] [188534] (12 PDB entries)

8. Domain d2ie2f_: 2ie2 F: [165527]
   automated match to d1mova_

Details for d2ie2f_

PDB Entry: 2ie2, 1.7 Å

PDB Description: the 1.7 a crystal structure of dronpa: a photoswitchable green fluorescent protein

PDB Compounds: (F:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d2ie2f_:

Sequence; same for both SEQRES and ATOM records:

>d2ie2f_ d.22.1.0 (F:) automated matches {Echinophyllia sp. [TaxId: 301887]}
svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
vvqlpdyhfvdhhieikshdkdysnvnlhehaeahs

Timeline for d2ie2f_:

• d2ie2f_ first appeared in SCOPe 2.01
  
• d2ie2f_ appears in SCOPe 2.03
  
• d2ie2f_ appears in SCOPe 2.05
  
• d2ie2f_ appears in the current release, SCOPe 2.08