Lineage for d2ie2e_ (2ie2 E:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546826Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2546827Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2547682Family d.22.1.0: automated matches [191400] (1 protein)
    not a true family
  6. 2547683Protein automated matches [190526] (25 species)
    not a true protein
  7. 2547822Species Echinophyllia sp. [TaxId:301887] [188534] (31 PDB entries)
  8. 2547867Domain d2ie2e_: 2ie2 E: [165526]
    automated match to d1mova_

Details for d2ie2e_

PDB Entry: 2ie2 (more details), 1.7 Å

PDB Description: the 1.7 a crystal structure of dronpa: a photoswitchable green fluorescent protein
PDB Compounds: (E:) Fluorescent protein Dronpa

SCOPe Domain Sequences for d2ie2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ie2e_ d.22.1.0 (E:) automated matches {Echinophyllia sp. [TaxId: 301887]}
svikpdmkiklrmegavnghpfaiegvglgkpfegkqsmdlkvkeggplpfaydilttvf
cygnrvfakypenivdyfkqsfpegyswersmnyedggicnatnditldgdcyiyeirfd
gvnfpangpvmqkrtvkwepsteklyvrdgvlkgdvnmalsleggghyrcdfkttykakk
vvqlpdyhfvdhhieikshdkdysnvnlhehaeahse

SCOPe Domain Coordinates for d2ie2e_:

Click to download the PDB-style file with coordinates for d2ie2e_.
(The format of our PDB-style files is described here.)

Timeline for d2ie2e_: