SCOPe 2.02: Domain d2idxb_: 2idx B:

Lineage for d2idxb_ (2idx B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families)
   crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site

5. Family a.25.2.0: automated matches [191442] (1 protein)
   not a true family

6. Protein automated matches [190652] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187855] (1 PDB entry)

8. Domain d2idxb_: 2idx B: [165519]
   automated match to d1rtyb_
   complexed with atp, cl, mg, so4

Details for d2idxb_

PDB Entry: 2idx, 2.5 Å

PDB Description: structure of human atp:cobalamin adenosyltransferase bound to atp.

PDB Compounds: (B:) Cob(I)yrinic acid a,c-diamide adenosyltransferase

SCOPe Domain Sequences for d2idxb_:

Sequence, based on SEQRES records:

>d2idxb_ a.25.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kiytktgdkgfsstftgerrpkddqvfeavgttdelssaigfalelvtekghtfaeelqk
iqctlqdvgsalatpcssareahlkyttfkagpileleqwidkytsqlppltafilpsgg
kissalhfcravcrraerrvvplvqmgetdanvakflnrlsdylftlaryaamkegnqek
iymk

Sequence, based on observed residues (ATOM records):

>d2idxb_ a.25.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kiytktgdkgfsstftgerrpkddqvfeavgttdelssaigfalelvtekghtfaeelqk
iqctlqdvgsalatpcssayttfkagpileleqwidkytsqlppltafilpsggkissal
hfcravcrraerrvvplvqmgetdanvakflnrlsdylftlaryaamkegnqekiymk

Timeline for d2idxb_:

• d2idxb_ first appeared in SCOPe 2.01
  
• d2idxb_ appears in SCOPe 2.03
  
• d2idxb_ appears in the current release, SCOPe 2.08