SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2idsa_ (2ids A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2036241Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2036242Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2036243Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 protein domains)
    mono-domain proteins
  6. 2036244Protein Amicyanin [49505] (2 species)
  7. 2036245Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries)
    Uniprot P22364
  8. 2036255Domain d2idsa_: 2ids A: [165515]
    automated match to d1aaca_
    complexed with cu1; mutant

Details for d2idsa_

PDB Entry: 2ids (more details), 1 Å

PDB Description: Structure of M98A mutant of amicyanin, Cu(I)
PDB Compounds: (A:) amicyanin

SCOPe Domain Sequences for d2idsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2idsa_ b.6.1.1 (A:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfargkvvve

SCOPe Domain Coordinates for d2idsa_:

Click to download the PDB-style file with coordinates for d2idsa_.
(The format of our PDB-style files is described here.)

Timeline for d2idsa_: