SCOPe 2.01: Domain d2idma_: 2idm A:

Lineage for d2idma_ (2idm A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (5 species)

7. Species Escherichia coli [TaxId:562] [52175] (36 PDB entries)
   Uniprot P06143

8. Domain d2idma_: 2idm A: [165511]
   automated match to d1c4wa_
   complexed with act

Details for d2idma_

PDB Entry: 2idm, 2 Å

PDB Description: 2.00 a structure of t87i/y106w phosphono-chey

PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d2idma_:

Sequence; same for both SEQRES and ATOM records:

>d2idma_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfviscwnmp
nmdglellktiradgamsalpvlmviaeakkeniiaaaqagasgwvvkpftaatleekln
kifeklgm

Timeline for d2idma_:

• d2idma_ is new in SCOPe 2.01-stable
  
• d2idma_ appears in SCOPe 2.02
  
• d2idma_ appears in the current release, SCOPe 2.08