Lineage for d1e86a_ (1e86 A:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46463Fold a.24: Four-helical up-and-down bundle [47161] (12 superfamilies)
  4. 46499Superfamily a.24.3: Cytochromes [47175] (2 families) (S)
  5. 46508Family a.24.3.2: Cytochrome c' [47179] (1 protein)
  6. 46509Protein Cytochrome c' [47180] (7 species)
  7. 46512Species Alcaligenes sp. [TaxId:512] [47184] (5 PDB entries)
  8. 46515Domain d1e86a_: 1e86 A: [16551]

Details for d1e86a_

PDB Entry: 1e86 (more details), 1.95 Å

PDB Description: cytochrome c' from alcaligenes xylosoxidans - reduced structure with co bound to distal side of heme

SCOP Domain Sequences for d1e86a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e86a_ a.24.3.2 (A:) Cytochrome c' {Alcaligenes sp.}
efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrkk

SCOP Domain Coordinates for d1e86a_:

Click to download the PDB-style file with coordinates for d1e86a_.
(The format of our PDB-style files is described here.)

Timeline for d1e86a_: