![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.21: Molybdenum cofactor biosynthesis protein C, MoaC [55040] (2 families) ![]() |
![]() | Family d.58.21.0: automated matches [191458] (1 protein) not a true family |
![]() | Protein automated matches [190706] (6 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [187852] (5 PDB entries) |
![]() | Domain d2idei_: 2ide I: [165505] automated match to d1ekra_ complexed with po4 |
PDB Entry: 2ide (more details), 1.9 Å
SCOPe Domain Sequences for d2idei_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2idei_ d.58.21.0 (I:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} rprmvdvtekpetfrtataeafvelteealsalekggvgkgdplvvaqlagilaakktad liplchplpltgvevrvellkaekrvrieatvktkaetgvemeamtacavaaltvydmlk aaskglvisqvrllhkaggksgewrre
Timeline for d2idei_: