SCOPe 2.07: Domain d2id7a_: 2id7 A:

Lineage for d2id7a_ (2id7 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (5 species)

7. Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
   Uniprot P06143

8. Domain d2id7a_: 2id7 A: [165495]
   automated match to d1c4wa_

Details for d2id7a_

PDB Entry: 2id7, 1.75 Å

PDB Description: 1.75 a structure of t87i phosphono-chey

PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d2id7a_:

Sequence; same for both SEQRES and ATOM records:

>d2id7a_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfviscwnmp
nmdglellktiradgamsalpvlmviaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

Timeline for d2id7a_:

• d2id7a_ first appeared in SCOPe 2.01
  
• d2id7a_ appears in SCOPe 2.06
  
• d2id7a_ appears in the current release, SCOPe 2.08