Lineage for d2id2c_ (2id2 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1875571Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 1875572Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 1875573Family c.82.1.1: ALDH-like [53721] (6 proteins)
  6. 1875878Protein automated matches [190401] (5 species)
    not a true protein
  7. 1875923Species Streptococcus mutans [TaxId:1309] [187673] (3 PDB entries)
  8. 1875930Domain d2id2c_: 2id2 C: [165493]
    automated match to d1euha_
    complexed with nap, so4; mutant

Details for d2id2c_

PDB Entry: 2id2 (more details), 2.5 Å

PDB Description: gapn t244s mutant x-ray structure at 2.5 a
PDB Compounds: (C:) NADP-dependent glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2id2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2id2c_ c.82.1.1 (C:) automated matches {Streptococcus mutans [TaxId: 1309]}
tkqyknyvngewklseneikiyepasgaelgsvpamsteevdyvyasakkaqpawralsy
ieraaylhkvadilmrdkekigailskevakgyksavsevvrtaeiinyaaeeglrmege
vleggsfeaaskkkiavvrrepvglvlaispfnypvnlagskiapaliagnviafkpptq
gsisglllaeafaeaglpagvfntitgrgseigdyivehqavnfinfsgstgigerigkm
agmrpimlelggkdsaivledadleltakniiagafgysgqrctavkrvlvmesvadelv
ekirekvlaltignpeddaditplidtksadyveglindandkgatalteikregnlicp
ilfdkvttdmrlaweepfgpvlpiirvtsveeaieisnkseyglqasiftndfprafgia
eqlevgtvhinnktqrgtdnfpflgakksgagiqgvkysieamttvksvvfdik

SCOPe Domain Coordinates for d2id2c_:

Click to download the PDB-style file with coordinates for d2id2c_.
(The format of our PDB-style files is described here.)

Timeline for d2id2c_: