Lineage for d2id2a_ (2id2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2908566Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2908567Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2908568Family c.82.1.1: ALDH-like [53721] (6 proteins)
  6. 2908891Protein automated matches [190401] (5 species)
    not a true protein
  7. 2908969Species Streptococcus mutans [TaxId:1309] [187673] (3 PDB entries)
  8. 2908970Domain d2id2a_: 2id2 A: [165491]
    automated match to d1euha_
    complexed with nap, so4; mutant

Details for d2id2a_

PDB Entry: 2id2 (more details), 2.5 Å

PDB Description: gapn t244s mutant x-ray structure at 2.5 a
PDB Compounds: (A:) NADP-dependent glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2id2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2id2a_ c.82.1.1 (A:) automated matches {Streptococcus mutans [TaxId: 1309]}
kqyknyvngewklseneikiyepasgaelgsvpamsteevdyvyasakkaqpawralsyi
eraaylhkvadilmrdkekigailskevakgyksavsevvrtaeiinyaaeeglrmegev
leggsfeaaskkkiavvrrepvglvlaispfnypvnlagskiapaliagnviafkpptqg
sisglllaeafaeaglpagvfntitgrgseigdyivehqavnfinfsgstgigerigkma
gmrpimlelggkdsaivledadleltakniiagafgysgqrctavkrvlvmesvadelve
kirekvlaltignpeddaditplidtksadyveglindandkgatalteikregnlicpi
lfdkvttdmrlaweepfgpvlpiirvtsveeaieisnkseyglqasiftndfprafgiae
qlevgtvhinnktqrgtdnfpflgakksgagiqgvkysieamttvksvvfdik

SCOPe Domain Coordinates for d2id2a_:

Click to download the PDB-style file with coordinates for d2id2a_.
(The format of our PDB-style files is described here.)

Timeline for d2id2a_: