Lineage for d1e85a_ (1e85 A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (11 superfamilies) Superfamily a.24.3: Cytochromes [47175] (2 families) 
Family a.24.3.2: Cytochrome c' [47179] (1 protein) Protein Cytochrome c' [47180] (7 species) Species Alcaligenes sp. [TaxId:512] [47184] (5 PDB entries) 
Domain d1e85a_: 1e85 A: [16549]
Details for d1e85a_
PDB Entry: 1e85 (more details), 1.35 Å
PDB Description: cytochrome c' from alcaligenes xylosoxidans - reduced structure with no bound to proximal side of heme
SCOP Domain Sequences for d1e85a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e85a_ a.24.3.2 (A:) Cytochrome c' {Alcaligenes sp.}
efakpedavkyrqsaltlmashfgrmtpvvkgqapydaaqikanvevlktlsalpwaafg
pgteggdarpeiwsdaasfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dayrk
SCOP Domain Coordinates for d1e85a_:
Click to download the PDB-style file with coordinates for d1e85a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1e85a_:
- d1e85a_ appears in SCOP 1.57
- d1e85a_ appears in the current release, SCOPe 2.08
View in 3D