SCOPe 2.01: Domain d2icua_: 2icu A:

Lineage for d2icua_ (2icu A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.303: BB1717-like [143080] (1 superfamily)
   complex fold with a bifurcated beta-sheet structure surrounded by helices; contains beta-sheet barrel, closed (n=5, S=8)

4. Superfamily d.303.1: BB1717-like [143081] (2 families)

5. Family d.303.1.0: automated matches [191457] (1 protein)
   not a true family

6. Protein automated matches [190705] (1 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [187851] (1 PDB entry)

8. Domain d2icua_: 2icu A: [165489]
   automated match to d2bdva1

Details for d2icua_

PDB Entry: 2icu, 1.6 Å

PDB Description: crystal structure of hypothetical protein yedk from escherichia coli

PDB Compounds: (A:) Hypothetical protein yedK

SCOPe Domain Sequences for d2icua_:

Sequence, based on SEQRES records:

>d2icua_ d.303.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
grfaqsqtredylallaedierdipydpepigrynvapgtkvlllserdehlhldpvfwg
yapgwwdkpplinarvetaatsrmfkplwqhgraicfadgwfewkkegdkkqpffiyrad
gqpifmaaigstpfergdeaegflivtaaadqglvdihdrrplvlspeaarewmrqeisg
keaseiaasgcvpanqfswhpvsravgnvknqgaeliqpv

Sequence, based on observed residues (ATOM records):

>d2icua_ d.303.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
grfaqsqtredylallaedierdipydpepigrynvapgtkvlllserdehlhldpvfwg
yapgpplinarvetaatsrmfkplwqhgraicfadgwfewkqpffiyradgqpifmaaig
stpfergdeaegflivtaaadqglvdihdrrplvlspeaarewmrqeisgkeaseiaasg
cvpanqfswhpvsravgnvknqgaeliqpv

Timeline for d2icua_:

• d2icua_ is new in SCOPe 2.01-stable
  
• d2icua_ appears in SCOPe 2.02
  
• d2icua_ appears in the current release, SCOPe 2.08