![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily) beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4) |
![]() | Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) ![]() |
![]() | Family d.120.1.1: Cytochrome b5 [55857] (5 proteins) |
![]() | Protein Cytochrome b5 [55858] (4 species) |
![]() | Species House fly (Musca domestica) [TaxId:7370] [187849] (1 PDB entry) |
![]() | Domain d2ibja_: 2ibj A: [165483] automated match to d1b5ma_ complexed with hem, mg |
PDB Entry: 2ibj (more details), 1.55 Å
SCOPe Domain Sequences for d2ibja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ibja_ d.120.1.1 (A:) Cytochrome b5 {House fly (Musca domestica) [TaxId: 7370]} sedvkyftraevaknntkdknwfiihnnvydvtaflnehpggeevlieqagkdatehfed vghssdaremmkqykvgelvaeersn
Timeline for d2ibja_: