Lineage for d2ibja_ (2ibj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973074Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 2973075Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 2973076Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)
  6. 2973077Protein Cytochrome b5 [55858] (4 species)
  7. 2973097Species House fly (Musca domestica) [TaxId:7370] [187849] (1 PDB entry)
  8. 2973098Domain d2ibja_: 2ibj A: [165483]
    automated match to d1b5ma_
    complexed with hem, mg

Details for d2ibja_

PDB Entry: 2ibj (more details), 1.55 Å

PDB Description: structure of house fly cytochrome b5
PDB Compounds: (A:) cytochrome b5

SCOPe Domain Sequences for d2ibja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ibja_ d.120.1.1 (A:) Cytochrome b5 {House fly (Musca domestica) [TaxId: 7370]}
sedvkyftraevaknntkdknwfiihnnvydvtaflnehpggeevlieqagkdatehfed
vghssdaremmkqykvgelvaeersn

SCOPe Domain Coordinates for d2ibja_:

Click to download the PDB-style file with coordinates for d2ibja_.
(The format of our PDB-style files is described here.)

Timeline for d2ibja_: