SCOPe 2.08: Domain d1cgna_: 1cgn A:

Lineage for d1cgna_ (1cgn A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
   automatically mapped to Pfam PF01322

6. Protein Cytochrome c' [47180] (9 species)

7. Species Alcaligenes denitrificans [TaxId:32002] [47183] (1 PDB entry)

8. Domain d1cgna_: 1cgn A: [16548]
   complexed with hec

Details for d1cgna_

PDB Entry: 1cgn, 2.15 Å

PDB Description: cytochrome c'

PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d1cgna_:

Sequence; same for both SEQRES and ATOM records:

>d1cgna_ a.24.3.2 (A:) Cytochrome c' {Alcaligenes denitrificans [TaxId: 32002]}
efakpedavkyrqsaltlmashfgrmapvvkgqapydaaqikanvevlktltalpwaafg
agteggdarpeiwsdaagfkqkqqafqdnivklsaaadagdldklraafgdvgasckach
dsyrk

Timeline for d1cgna_:

• d1cgna_ first appeared (with stable ids) in SCOP 1.55, called d1cgn__
  
• d1cgna_ appears in SCOPe 2.07