Lineage for d2ib6b_ (2ib6 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940279Species Cnidopus japonicus [TaxId:380086] [188533] (2 PDB entries)
  8. 2940289Domain d2ib6b_: 2ib6 B: [165476]
    automated match to d1xqma_
    complexed with po4; mutant

Details for d2ib6b_

PDB Entry: 2ib6 (more details), 2 Å

PDB Description: Structural characterization of a blue chromoprotein and its yellow mutant from the sea anemone cnidopus japonicus
PDB Compounds: (B:) Yellow mutant chromo protein

SCOPe Domain Sequences for d2ib6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ib6b_ d.22.1.1 (B:) automated matches {Cnidopus japonicus [TaxId: 380086]}
isdnvriklymegtvnnhhfmceaegegkpyegtqmenikvtkggplpfsfdiltpncql
gsvaitkytsgipdyfkqsfpegftwerttiyedgaylttqqetkldgnclvynikilgc
nfppngpvmqkktqgwepccemrytrdgvlcgqtlmalkcadgnhltchlrttyrskkaa
kalqmppfhfsdhrpeivkvsengtlfeqhessvarycqtcpsklghn

SCOPe Domain Coordinates for d2ib6b_:

Click to download the PDB-style file with coordinates for d2ib6b_.
(The format of our PDB-style files is described here.)

Timeline for d2ib6b_: