Lineage for d2ib5e_ (2ib5 E:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021948Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1021949Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1021950Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1022143Protein automated matches [190406] (14 species)
    not a true protein
  7. 1022162Species Cnidopus japonicus [TaxId:380086] [188533] (2 PDB entries)
  8. 1022167Domain d2ib5e_: 2ib5 E: [165471]
    automated match to d1xqma_
    complexed with po4; mutant

Details for d2ib5e_

PDB Entry: 2ib5 (more details), 1.8 Å

PDB Description: Structural characterization of a blue chromoprotein and its yellow mutant from the sea anemone cnidopus japonicus
PDB Compounds: (E:) Chromo protein

SCOPe Domain Sequences for d2ib5e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ib5e_ d.22.1.1 (E:) automated matches {Cnidopus japonicus [TaxId: 380086]}
isdnvriklymegtvnnhhfmceaegegkpyegtqmenikvtkggplpfsfdiltpncqy
gsvaitkytsgipdyfkqsfpegftwerttiyedgaylttqqetkldgnclvynikilgc
nfppngpvmqkktqgwepccemrytrdgvlcgqtlmalkcadgnhltchlrttyrskkaa
kalqmppfhfsdhrpeivkvsengtlfeqhessvarycqtcpsklghn

SCOPe Domain Coordinates for d2ib5e_:

Click to download the PDB-style file with coordinates for d2ib5e_.
(The format of our PDB-style files is described here.)

Timeline for d2ib5e_: