Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (14 species) not a true protein |
Species Cnidopus japonicus [TaxId:380086] [188533] (2 PDB entries) |
Domain d2ib5e_: 2ib5 E: [165471] automated match to d1xqma_ complexed with po4; mutant |
PDB Entry: 2ib5 (more details), 1.8 Å
SCOPe Domain Sequences for d2ib5e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ib5e_ d.22.1.1 (E:) automated matches {Cnidopus japonicus [TaxId: 380086]} isdnvriklymegtvnnhhfmceaegegkpyegtqmenikvtkggplpfsfdiltpncqy gsvaitkytsgipdyfkqsfpegftwerttiyedgaylttqqetkldgnclvynikilgc nfppngpvmqkktqgwepccemrytrdgvlcgqtlmalkcadgnhltchlrttyrskkaa kalqmppfhfsdhrpeivkvsengtlfeqhessvarycqtcpsklghn
Timeline for d2ib5e_: