SCOPe 2.06: Domain d1bbhb_: 1bbh B:

Lineage for d1bbhb_ (1bbh B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
   automatically mapped to Pfam PF01322

6. Protein Cytochrome c' [47180] (9 species)

7. Species Chromatium vinosum [TaxId:1049] [47182] (1 PDB entry)

8. Domain d1bbhb_: 1bbh B: [16547]
   complexed with hem

Details for d1bbhb_

PDB Entry: 1bbh, 1.8 Å

PDB Description: atomic structure of a cytochrome c' with an unusual ligand-controlled dimer dissociation at 1.8 angstroms resolution

PDB Compounds: (B:) cytochrome c'

SCOPe Domain Sequences for d1bbhb_:

Sequence; same for both SEQRES and ATOM records:

>d1bbhb_ a.24.3.2 (B:) Cytochrome c' {Chromatium vinosum [TaxId: 1049]}
aglspeeqietrqagyefmgwnmgkikanlegeynaaqveaaanviaaiansgmgalygp
gtdknvgdvktrvkpeffqnmedvgkiarefvgaantlaevaatgeaeavktafgdvgaa
ckschekyrak

Timeline for d1bbhb_:

• d1bbhb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bbhb_ appears in SCOPe 2.05
  
• d1bbhb_ appears in SCOPe 2.07
  
• d1bbhb_ appears in the current release, SCOPe 2.08