| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.3: Cytochromes [47175] (3 families) ![]() Heme-containing proteins |
| Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins) automatically mapped to Pfam PF01322 |
| Protein Cytochrome c' [47180] (9 species) |
| Species Chromatium vinosum [TaxId:1049] [47182] (1 PDB entry) |
| Domain d1bbhb_: 1bbh B: [16547] complexed with hec |
PDB Entry: 1bbh (more details), 1.8 Å
SCOPe Domain Sequences for d1bbhb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bbhb_ a.24.3.2 (B:) Cytochrome c' {Chromatium vinosum [TaxId: 1049]}
aglspeeqietrqagyefmgwnmgkikanlegeynaaqveaaanviaaiansgmgalygp
gtdknvgdvktrvkpeffqnmedvgkiarefvgaantlaevaatgeaeavktafgdvgaa
ckschekyrak
Timeline for d1bbhb_: