Lineage for d1bbha_ (1bbh A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.24: Four-helical up-and-down bundle [47161] (11 superfamilies) Superfamily a.24.3: Cytochromes [47175] (2 families) 
Family a.24.3.2: Cytochrome c' [47179] (1 protein) Protein Cytochrome c' [47180] (7 species) 
Species Chromatium vinosum [TaxId:1049] [47182] (1 PDB entry) 
Domain d1bbha_: 1bbh A: [16546]
Details for d1bbha_
PDB Entry: 1bbh (more details), 1.8 Å
PDB Description: atomic structure of a cytochrome c' with an unusual ligand-controlled dimer dissociation at 1.8 angstroms resolution
SCOP Domain Sequences for d1bbha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bbha_ a.24.3.2 (A:) Cytochrome c' {Chromatium vinosum}
aglspeeqietrqagyefmgwnmgkikanlegeynaaqveaaanviaaiansgmgalygp
gtdknvgdvktrvkpeffqnmedvgkiarefvgaantlaevaatgeaeavktafgdvgaa
ckschekyrak
SCOP Domain Coordinates for d1bbha_:
Click to download the PDB-style file with coordinates for d1bbha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bbha_:
- d1bbha_ appears in SCOP 1.57
- d1bbha_ appears in the current release, SCOPe 2.08
View in 3D
