![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
![]() | Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families) ![]() |
![]() | Family c.43.1.0: automated matches [191456] (1 protein) not a true family |
![]() | Protein automated matches [190703] (2 species) not a true protein |
![]() | Species Bacteroides thetaiotaomicron [TaxId:226186] [187847] (1 PDB entry) |
![]() | Domain d2i9dc_: 2i9d C: [165446] automated match to d1qcaa_ |
PDB Entry: 2i9d (more details), 2.3 Å
SCOPe Domain Sequences for d2i9dc_:
Sequence, based on SEQRES records: (download)
>d2i9dc_ c.43.1.0 (C:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} snamkqiidienwerkenfnffrhfqnpqlsitsevecggarqrakaagqsfflhylyav lraaneipefryridpdgrvvlydtidmlspikikengkffttrfpyhndfdtfyqearl iidaipedgdpyaaeneevadgdyglillsatpdlyftsitgtqekrsgnnypllnagka iiregrlvmpiamtihhgfidghhlslfykkvedflk
>d2i9dc_ c.43.1.0 (C:) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} snamkqiidienwerkenfnffrhfqnpqlsitsevecggarqrakaagqsfflhylyav lraaneipefryridpdgrvvlydtidmlspiffttrfpyhndfdtfyqearliidagdy glillsatpdlyftsitgtqekrsgnnypllnagkaiiregrlvmpiamtihhgfidghh lslfykkvedflk
Timeline for d2i9dc_: