Lineage for d2i9dc1 (2i9d C:1-214)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115786Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2115787Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2115972Family c.43.1.0: automated matches [191456] (1 protein)
    not a true family
  6. 2115973Protein automated matches [190703] (6 species)
    not a true protein
  7. 2115974Species Bacteroides thetaiotaomicron [TaxId:226186] [187847] (1 PDB entry)
  8. 2115977Domain d2i9dc1: 2i9d C:1-214 [165446]
    Other proteins in same PDB: d2i9db2, d2i9dc2
    automated match to d1qcaa_

Details for d2i9dc1

PDB Entry: 2i9d (more details), 2.3 Å

PDB Description: chloramphenicol acetyltransferase
PDB Compounds: (C:) Chloramphenicol acetyltransferase

SCOPe Domain Sequences for d2i9dc1:

Sequence, based on SEQRES records: (download)

>d2i9dc1 c.43.1.0 (C:1-214) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
mkqiidienwerkenfnffrhfqnpqlsitsevecggarqrakaagqsfflhylyavlra
aneipefryridpdgrvvlydtidmlspikikengkffttrfpyhndfdtfyqearliid
aipedgdpyaaeneevadgdyglillsatpdlyftsitgtqekrsgnnypllnagkaiir
egrlvmpiamtihhgfidghhlslfykkvedflk

Sequence, based on observed residues (ATOM records): (download)

>d2i9dc1 c.43.1.0 (C:1-214) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]}
mkqiidienwerkenfnffrhfqnpqlsitsevecggarqrakaagqsfflhylyavlra
aneipefryridpdgrvvlydtidmlspiffttrfpyhndfdtfyqearliidagdygli
llsatpdlyftsitgtqekrsgnnypllnagkaiiregrlvmpiamtihhgfidghhlsl
fykkvedflk

SCOPe Domain Coordinates for d2i9dc1:

Click to download the PDB-style file with coordinates for d2i9dc1.
(The format of our PDB-style files is described here.)

Timeline for d2i9dc1: