SCOPe 2.08: Domain d2i8ub_: 2i8u B:

Lineage for d2i8ub_ (2i8u B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.5: GDP-mannose mannosyl hydrolase NudD [111132] (2 proteins)

6. Protein automated matches [190949] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [188546] (2 PDB entries)

8. Domain d2i8ub_: 2i8u B: [165443]
   automated match to d1ryaa_
   complexed with ca, gdp

Details for d2i8ub_

PDB Entry: 2i8u, 1.4 Å

PDB Description: gdp-mannose mannosyl hydrolase-calcium-gdp product complex

PDB Compounds: (B:) GDP-mannose mannosyl hydrolase

SCOPe Domain Sequences for d2i8ub_:

Sequence; same for both SEQRES and ATOM records:

>d2i8ub_ d.113.1.5 (B:) automated matches {Escherichia coli [TaxId: 562]}
mflrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetlea
aferltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvaeeelllpd
eqhddyrwltpdallasenvhansrvyfn

Timeline for d2i8ub_:

• d2i8ub_ first appeared in SCOPe 2.01
  
• d2i8ub_ appears in SCOPe 2.07