![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
![]() | Superfamily d.113.1: Nudix [55811] (8 families) ![]() |
![]() | Family d.113.1.5: GDP-mannose mannosyl hydrolase NudD [111132] (2 proteins) |
![]() | Protein automated matches [190949] (1 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [188546] (2 PDB entries) |
![]() | Domain d2i8ta_: 2i8t A: [165440] automated match to d1ryaa_ complexed with ca, gdd, gol |
PDB Entry: 2i8t (more details), 1.3 Å
SCOPe Domain Sequences for d2i8ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i8ta_ d.113.1.5 (A:) automated matches {Escherichia coli [TaxId: 562]} mmflrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetle aaferltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvaeeelllp deqhddyrwltpdallasenvhansrvyf
Timeline for d2i8ta_: