Lineage for d2i8ta_ (2i8t A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971742Family d.113.1.5: GDP-mannose mannosyl hydrolase NudD [111132] (2 proteins)
  6. 2971754Protein automated matches [190949] (1 species)
    not a true protein
  7. 2971755Species Escherichia coli [TaxId:562] [188546] (2 PDB entries)
  8. 2971756Domain d2i8ta_: 2i8t A: [165440]
    automated match to d1ryaa_
    complexed with ca, gdd, gol

Details for d2i8ta_

PDB Entry: 2i8t (more details), 1.3 Å

PDB Description: GDP-mannose mannosyl hydrolase-calcium-GDP-mannose complex
PDB Compounds: (A:) GDP-mannose mannosyl hydrolase

SCOPe Domain Sequences for d2i8ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i8ta_ d.113.1.5 (A:) automated matches {Escherichia coli [TaxId: 562]}
mmflrqedfatvvrstplvsldfivensrgefllgkrtnrpaqgywfvpggrvqkdetle
aaferltmaelglrlpitagqfygvwqhfyddnfsgtdftthyvvlgfrfrvaeeelllp
deqhddyrwltpdallasenvhansrvyf

SCOPe Domain Coordinates for d2i8ta_:

Click to download the PDB-style file with coordinates for d2i8ta_.
(The format of our PDB-style files is described here.)

Timeline for d2i8ta_: