SCOPe 2.05: Domain d2ccya_: 2ccy A:

Lineage for d2ccya_ (2ccy A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.2: Cytochrome c'-like [47179] (3 proteins)
   automatically mapped to Pfam PF01322

6. Protein Cytochrome c' [47180] (8 species)

7. Species Rhodospirillum molischianum [TaxId:1083] [47181] (1 PDB entry)

8. Domain d2ccya_: 2ccy A: [16544]
   complexed with hem

Details for d2ccya_

PDB Entry: 2ccy, 1.67 Å

PDB Description: structure of ferricytochrome c(prime) from rhodospirillum molischianum at 1.67 angstroms resolution

PDB Compounds: (A:) cytochrome c

SCOPe Domain Sequences for d2ccya_:

Sequence; same for both SEQRES and ATOM records:

>d2ccya_ a.24.3.2 (A:) Cytochrome c' {Rhodospirillum molischianum [TaxId: 1083]}
qskpedllklrqglmqtlksqwvpiagfaagkadlpadaaqraenmamvaklapigwakg
tealpngetkpeafgsksaeflegwkalatestklaaaakagpdalkaqaaatgkvckac
heefkqd

Timeline for d2ccya_:

• d2ccya_ first appeared (with stable ids) in SCOP 1.55
  
• d2ccya_ appears in SCOPe 2.04
  
• d2ccya_ appears in SCOPe 2.06
  
• d2ccya_ appears in the current release, SCOPe 2.08