Lineage for d2i8ab_ (2i8a B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 996821Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 996837Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 996838Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 997163Protein Uridine phosphorylase [53176] (2 species)
  7. 997265Species Salmonella typhimurium [TaxId:90371] [117656] (22 PDB entries)
    Uniprot P0A1F6
  8. 997285Domain d2i8ab_: 2i8a B: [165435]
    automated match to d1ryza_
    complexed with po4

Details for d2i8ab_

PDB Entry: 2i8a (more details), 1.64 Å

PDB Description: salmonella typhimurium liganded by phosphate ion at 1.64a resolution
PDB Compounds: (B:) Uridine phosphorylase

SCOPe Domain Sequences for d2i8ab_:

Sequence, based on SEQRES records: (download)

>d2i8ab_ c.56.2.1 (B:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
ksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkav
ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
fapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkg
smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqeipnaetmkqteshav
kivveaarrll

Sequence, based on observed residues (ATOM records): (download)

>d2i8ab_ c.56.2.1 (B:) Uridine phosphorylase {Salmonella typhimurium [TaxId: 90371]}
ksdvfhlgltkndlqgaqlaivpgdpervekiaalmdkpvklashreftswraeldgkav
ivcstgiggpstsiaveelaqlgirtflrigttgaiqphinvgdvlvttasvrldgaslh
fapmefpavadfacttalveaaksigatthvgvtassdtfypgqerydtysgrvvrrfkg
smeewqamgvmnyemesatlltmcasqglragmvagvivnrtqqshavkivveaarrll

SCOPe Domain Coordinates for d2i8ab_:

Click to download the PDB-style file with coordinates for d2i8ab_.
(The format of our PDB-style files is described here.)

Timeline for d2i8ab_: