SCOPe 2.04: Domain d2i7fb_: 2i7f B:

Lineage for d2i7fb_ (2i7f B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.0: automated matches [191455] (1 protein)
   not a true family

6. Protein automated matches [190701] (10 species)
   not a true protein

7. Species Sphingobium yanoikuyae [TaxId:13690] [187845] (3 PDB entries)

8. Domain d2i7fb_: 2i7f B: [165423]
   automated match to d1fqta_
   complexed with cit, fes, so4

Details for d2i7fb_

PDB Entry: 2i7f, 1.9 Å

PDB Description: sphingomonas yanoikuyae b1 ferredoxin

PDB Compounds: (B:) Ferredoxin component of dioxygenase

SCOPe Domain Sequences for d2i7fb_:

Sequence; same for both SEQRES and ATOM records:

>d2i7fb_ b.33.1.0 (B:) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
nklrlcqvasvkdgepvavyqekmpalavynvdgevfvtdnlcthgnamltdgyqdgtii
ecpfhggsfdiatgaakafpcqipiktypvtiedgwvcidqp

Timeline for d2i7fb_:

• d2i7fb_ first appeared in SCOPe 2.01
  
• d2i7fb_ appears in SCOPe 2.03
  
• d2i7fb_ appears in SCOPe 2.05
  
• d2i7fb_ appears in the current release, SCOPe 2.08