Lineage for d2i7fb_ (2i7f B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782333Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 2782334Superfamily b.33.1: ISP domain [50022] (4 families) (S)
  5. 2782562Family b.33.1.0: automated matches [191455] (1 protein)
    not a true family
  6. 2782563Protein automated matches [190701] (13 species)
    not a true protein
  7. 2782712Species Sphingobium yanoikuyae [TaxId:13690] [187845] (3 PDB entries)
  8. 2782717Domain d2i7fb_: 2i7f B: [165423]
    automated match to d1fqta_
    complexed with cit, fes, so4

Details for d2i7fb_

PDB Entry: 2i7f (more details), 1.9 Å

PDB Description: sphingomonas yanoikuyae b1 ferredoxin
PDB Compounds: (B:) Ferredoxin component of dioxygenase

SCOPe Domain Sequences for d2i7fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i7fb_ b.33.1.0 (B:) automated matches {Sphingobium yanoikuyae [TaxId: 13690]}
nklrlcqvasvkdgepvavyqekmpalavynvdgevfvtdnlcthgnamltdgyqdgtii
ecpfhggsfdiatgaakafpcqipiktypvtiedgwvcidqp

SCOPe Domain Coordinates for d2i7fb_:

Click to download the PDB-style file with coordinates for d2i7fb_.
(The format of our PDB-style files is described here.)

Timeline for d2i7fb_: