SCOPe 2.06: Domain d2i6bb_: 2i6b B:

Lineage for d2i6bb_ (2i6b B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (6 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
   automatically mapped to Pfam PF00294

6. Protein Adenosine kinase [53617] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53618] (4 PDB entries)

8. Domain d2i6bb_: 2i6b B: [165415]
   automated match to d1bx4a_
   complexed with 89i

Details for d2i6bb_

PDB Entry: 2i6b, 2.3 Å

PDB Description: human adenosine kinase in complex with an acetylinic inhibitor

PDB Compounds: (B:) adenosine kinase

SCOPe Domain Sequences for d2i6bb_:

Sequence; same for both SEQRES and ATOM records:

>d2i6bb_ c.72.1.1 (B:) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]}
svrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyha
ggstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqptgt
caacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvlkv
ahhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkdik
eiakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagdaf
vggflsqlvsdkplteciraghyaas

Timeline for d2i6bb_:

• d2i6bb_ first appeared in SCOPe 2.01
  
• d2i6bb_ appears in SCOPe 2.05
  
• d2i6bb_ appears in SCOPe 2.07
  
• d2i6bb_ appears in the current release, SCOPe 2.08