SCOPe 2.05: Domain d1qq3a_: 1qq3 A:

Lineage for d1qq3a_ (1qq3 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
   automatically mapped to Pfam PF07361

6. Protein Cytochrome b562 [47177] (1 species)

7. Species Escherichia coli [TaxId:562] [47178] (6 PDB entries)

8. Domain d1qq3a_: 1qq3 A: [16541]
   complexed with heb

Details for d1qq3a_

PDB Entry: 1qq3

PDB Description: the solution structure of the heme binding variant arg98cys of oxidized escherichia coli cytochrome b562

PDB Compounds: (A:) cytochrome b562

SCOPe Domain Sequences for d1qq3a_:

Sequence; same for both SEQRES and ATOM records:

>d1qq3a_ a.24.3.1 (A:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkd
frhgfdilvgqiddalklanegkvkeaqaaaeqlkttcnayhqkyr

Timeline for d1qq3a_:

• d1qq3a_ first appeared (with stable ids) in SCOP 1.55
  
• d1qq3a_ appears in SCOPe 2.04
  
• d1qq3a_ appears in SCOPe 2.06
  
• d1qq3a_ appears in the current release, SCOPe 2.08