SCOPe 2.06: Domain d2i62c_: 2i62 C:

Lineage for d2i62c_ (2i62 C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (64 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187843] (16 PDB entries)

8. Domain d2i62c_: 2i62 C: [165406]
   automated match to d2a14a1
   complexed with sah

Details for d2i62c_

PDB Entry: 2i62, 1.8 Å

PDB Description: mouse nicotinamide n-methyltransferase

PDB Compounds: (C:) Nicotinamide N-methyltransferase

SCOPe Domain Sequences for d2i62c_:

Sequence; same for both SEQRES and ATOM records:

>d2i62c_ c.66.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gftskdtylshfnprdylekyysfgsrhcaeneilrhllknlfkifclgavkgellidig
sgptiyqllsacesfteiivsdytdqnlwelqkwlkkepgafdwspvvtyvcdlegnrmk
gpekeeklrraikqvlkcdvtqsqplggvslppadcllstlcldaacpdlpayrtalrnl
gsllkpggflvmvdalkssyymigeqkfsslplgwetvrdaveeagytieqfevisqnys
sttsnneglfslvgrkpg

Timeline for d2i62c_:

• d2i62c_ first appeared in SCOPe 2.01
  
• d2i62c_ appears in SCOPe 2.05
  
• d2i62c_ appears in SCOPe 2.07
  
• d2i62c_ appears in the current release, SCOPe 2.08