Lineage for d2i55b_ (2i55 B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1010738Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1010739Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1010982Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 1011053Protein automated matches [190498] (5 species)
    not a true protein
  7. 1011066Species Trypanosome (Leishmania mexicana) [TaxId:5665] [187841] (2 PDB entries)
  8. 1011071Domain d2i55b_: 2i55 B: [165397]
    automated match to d2amya1
    complexed with b16, cl, mg

Details for d2i55b_

PDB Entry: 2i55 (more details), 2.9 Å

PDB Description: complex of glucose-1,6-bisphosphate with phosphomannomutase from leishmania mexicana
PDB Compounds: (B:) Phosphomannomutase

SCOPe Domain Sequences for d2i55b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i55b_ c.108.1.10 (B:) automated matches {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
kaillfdvdgtltpprnpethdmkeallkaraagfklgvvggsdfakqkeqlgesiledf
dyvfsengllaykdgkefhrnsllralgnekvvafvkkclhliadldipvqrgtfvefrn
gmfnvspigrncsqqerdefenldkerhireklirelkeafpdyqlaysvggqisfdvfp
kgwdktyclqfvendfetihffgdktseggndyeiftdsrtighsvktykdtiaileall
ed

SCOPe Domain Coordinates for d2i55b_:

Click to download the PDB-style file with coordinates for d2i55b_.
(The format of our PDB-style files is described here.)

Timeline for d2i55b_: