SCOPe 2.07: Domain d2i55a_: 2i55 A:

Lineage for d2i55a_ (2i55 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
   contains an alpha+beta subdomain inserted into a new site after strand 3

6. Protein automated matches [190498] (5 species)
   not a true protein

7. Species Trypanosome (Leishmania mexicana) [TaxId:5665] [187841] (2 PDB entries)

8. Domain d2i55a_: 2i55 A: [165396]
   automated match to d2amya1
   complexed with b16, cl, mg

Details for d2i55a_

PDB Entry: 2i55, 2.9 Å

PDB Description: complex of glucose-1,6-bisphosphate with phosphomannomutase from leishmania mexicana

PDB Compounds: (A:) Phosphomannomutase

SCOPe Domain Sequences for d2i55a_:

Sequence; same for both SEQRES and ATOM records:

>d2i55a_ c.108.1.10 (A:) automated matches {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
kaillfdvdgtltpprnpethdmkeallkaraagfklgvvggsdfakqkeqlgesiledf
dyvfsengllaykdgkefhrnsllralgnekvvafvkkclhliadldipvqrgtfvefrn
gmfnvspigrncsqqerdefenldkerhireklirelkeafpdyqlaysvggqisfdvfp
kgwdktyclqfvendfetihffgdktseggndyeiftdsrtighsvktykdtiaileall
ed

Timeline for d2i55a_:

• d2i55a_ first appeared in SCOPe 2.01
  
• d2i55a_ appears in SCOPe 2.06
  
• d2i55a_ appears in the current release, SCOPe 2.08