Lineage for d2i54c_ (2i54 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1883149Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1883150Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1883530Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 1883601Protein automated matches [190498] (5 species)
    not a true protein
  7. 1883614Species Trypanosome (Leishmania mexicana) [TaxId:5665] [187841] (2 PDB entries)
  8. 1883617Domain d2i54c_: 2i54 C: [165395]
    automated match to d2amya1
    complexed with cit, cl, mg

Details for d2i54c_

PDB Entry: 2i54 (more details), 2.1 Å

PDB Description: Phosphomannomutase from Leishmania mexicana
PDB Compounds: (C:) Phosphomannomutase

SCOPe Domain Sequences for d2i54c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i54c_ c.108.1.10 (C:) automated matches {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
kaillfdvdgtltpprnpethdmkeallkaraagfklgvvggsdfakqkeqlgesiledf
dyvfsengllaykdgkefhrnsllralgnekvvafvkkclhliadldipvqrgtfvefrn
gmfnvspigrncsqqerdefenldkerhireklirelkeafpdyqlaysvggqisfdvfp
kgwdktyclqfvendfetihffgdktseggndyeiftdsrtighsvktykdtiaileall
ed

SCOPe Domain Coordinates for d2i54c_:

Click to download the PDB-style file with coordinates for d2i54c_.
(The format of our PDB-style files is described here.)

Timeline for d2i54c_: