Lineage for d2i54a_ (2i54 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166914Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2166915Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2167325Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 2167396Protein automated matches [190498] (5 species)
    not a true protein
  7. 2167409Species Trypanosome (Leishmania mexicana) [TaxId:5665] [187841] (2 PDB entries)
  8. 2167410Domain d2i54a_: 2i54 A: [165393]
    automated match to d2amya1
    complexed with cit, cl, mg

Details for d2i54a_

PDB Entry: 2i54 (more details), 2.1 Å

PDB Description: Phosphomannomutase from Leishmania mexicana
PDB Compounds: (A:) Phosphomannomutase

SCOPe Domain Sequences for d2i54a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i54a_ c.108.1.10 (A:) automated matches {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
kaillfdvdgtltpprnpethdmkeallkaraagfklgvvggsdfakqkeqlgesiledf
dyvfsengllaykdgkefhrnsllralgnekvvafvkkclhliadldipvqrgtfvefrn
gmfnvspigrncsqqerdefenldkerhireklirelkeafpdyqlaysvggqisfdvfp
kgwdktyclqfvendfetihffgdktseggndyeiftdsrtighsvktykdtiaileall
ed

SCOPe Domain Coordinates for d2i54a_:

Click to download the PDB-style file with coordinates for d2i54a_.
(The format of our PDB-style files is described here.)

Timeline for d2i54a_: