Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins) contains an alpha+beta subdomain inserted into a new site after strand 3 |
Protein automated matches [190498] (5 species) not a true protein |
Species Trypanosome (Leishmania mexicana) [TaxId:5665] [187841] (2 PDB entries) |
Domain d2i54a_: 2i54 A: [165393] automated match to d2amya1 complexed with cit, cl, mg |
PDB Entry: 2i54 (more details), 2.1 Å
SCOPe Domain Sequences for d2i54a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i54a_ c.108.1.10 (A:) automated matches {Trypanosome (Leishmania mexicana) [TaxId: 5665]} kaillfdvdgtltpprnpethdmkeallkaraagfklgvvggsdfakqkeqlgesiledf dyvfsengllaykdgkefhrnsllralgnekvvafvkkclhliadldipvqrgtfvefrn gmfnvspigrncsqqerdefenldkerhireklirelkeafpdyqlaysvggqisfdvfp kgwdktyclqfvendfetihffgdktseggndyeiftdsrtighsvktykdtiaileall ed
Timeline for d2i54a_: