![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
![]() | Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins) |
![]() | Protein automated matches [190142] (21 species) not a true protein |
![]() | Species Trichomonas vaginalis [TaxId:5722] [187838] (9 PDB entries) |
![]() | Domain d2i4ta_: 2i4t A: [165390] automated match to d1a69a_ complexed with po4, ua2 |
PDB Entry: 2i4t (more details), 2.74 Å
SCOPe Domain Sequences for d2i4ta_:
Sequence, based on SEQRES records: (download)
>d2i4ta_ c.56.2.1 (A:) automated matches {Trichomonas vaginalis [TaxId: 5722]} atphnsaqvgdfaetvlmcgdplrakliaetylenpklvnnvrgiqgytgtykgkpisvm ghgmglpsiciyaeelystykvktiirvgtcgaidmdihtrdiviftsagtnskinrirf mdhdypatasfdvvcalvdaakelnipakvgkgfstdlfynpqtelaqlmnkfhflavem esaglfpiadlygaragcictvsdhilhheettaeerqnsfqnmmkialeaaiklh
>d2i4ta_ c.56.2.1 (A:) automated matches {Trichomonas vaginalis [TaxId: 5722]} atphnsaqvgdfaetvlmcgdplrakliaetylenpklvnnvrgiqgytgtykgkpisvm ghgmglpsiciyaeelystykvktiirvgtcgaidmdihtrdiviftsagtnskinrirf mdhdypatasfdvvcalvdaakelnipakvgkgfstdlfynpqtelaqlmnkfhflavem esaglfpiadlygaragcictvsdhilhherqnsfqnmmkialeaaiklh
Timeline for d2i4ta_: