SCOPe 2.08: Domain d256ba_: 256b A:

Lineage for d256ba_ (256b A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
   automatically mapped to Pfam PF07361

6. Protein Cytochrome b562 [47177] (1 species)

7. Species Escherichia coli [TaxId:562] [47178] (75 PDB entries)

8. Domain d256ba_: 256b A: [16539]
   complexed with hem, so4

Details for d256ba_

PDB Entry: 256b, 1.4 Å

PDB Description: improvement of the 2.5 angstroms resolution model of cytochrome b562 by redetermining the primary structure and using molecular graphics

PDB Compounds: (A:) cytochrome b562

SCOPe Domain Sequences for d256ba_:

Sequence; same for both SEQRES and ATOM records:

>d256ba_ a.24.3.1 (A:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmraaaldaqkatppkledkspdspemkd
frhgfdilvgqiddalklanegkvkeaqaaaeqlkttrnayhqkyr

Timeline for d256ba_:

• d256ba_ first appeared (with stable ids) in SCOP 1.55
  
• d256ba_ appears in SCOPe 2.07