Lineage for d2i4qb_ (2i4q B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 955287Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 955288Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 956278Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 956556Protein Chymosin (synonym: renin) [50667] (3 species)
  7. 956562Species Human (Homo sapiens) [TaxId:9606] [50669] (40 PDB entries)
  8. 956611Domain d2i4qb_: 2i4q B: [165389]
    automated match to d1bila_
    complexed with ua4

Details for d2i4qb_

PDB Entry: 2i4q (more details), 2.3 Å

PDB Description: Human renin/PF02342674 complex
PDB Compounds: (B:) renin

SCOPe Domain Sequences for d2i4qb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i4qb_ b.50.1.2 (B:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
nttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvyhklf
dasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfmlaef
dgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlggsdpq
hyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssieklme
algakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaihamd
ippptgptwalgatfirkfytefdrrnnrigfalar

SCOPe Domain Coordinates for d2i4qb_:

Click to download the PDB-style file with coordinates for d2i4qb_.
(The format of our PDB-style files is described here.)

Timeline for d2i4qb_: