Lineage for d2i4aa_ (2i4a A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876128Family c.47.1.1: Thioltransferase [52834] (16 proteins)
  6. 2876445Protein automated matches [190442] (13 species)
    not a true protein
  7. 2876446Species Acetobacter aceti [TaxId:435] [187839] (1 PDB entry)
  8. 2876447Domain d2i4aa_: 2i4a A: [165387]
    automated match to d1xoaa_
    complexed with bme

Details for d2i4aa_

PDB Entry: 2i4a (more details), 1 Å

PDB Description: crystal structure of thioredoxin from the acidophile acetobacter aceti
PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d2i4aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2i4aa_ c.47.1.1 (A:) automated matches {Acetobacter aceti [TaxId: 435]}
sehtlavsdssfdqdvlkasglvlvdfwaewcgpckmigpalgeigkefagkvtvakvni
ddnpetpnayqvrsiptlmlvrdgkvidkkvgalpksqlkawvesaq

SCOPe Domain Coordinates for d2i4aa_:

Click to download the PDB-style file with coordinates for d2i4aa_.
(The format of our PDB-style files is described here.)

Timeline for d2i4aa_: