| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
| Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
| Protein Glutamate receptor ligand binding core [53881] (5 species) |
| Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (158 PDB entries) |
| Domain d2i3vc_: 2i3v C: [165383] automated match to d1ftjb_ complexed with glu, zn; mutant |
PDB Entry: 2i3v (more details), 2.4 Å
SCOPe Domain Sequences for d2i3vc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2i3vc_ c.94.1.1 (C:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
ktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyga
rdadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpies
aedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvrk
skgkyayllestmneyieqrkpcdtmkvgcnldskgygiatpkgsslgnavnlavlklne
qglldklknkwwydkgec
Timeline for d2i3vc_: