SCOPe 2.01: Domain d2i3va_: 2i3v A:

Lineage for d2i3va_ (2i3v A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (101 PDB entries)

8. Domain d2i3va_: 2i3v A: [165381]
   automated match to d1ftjb_
   complexed with glu, zn; mutant

Details for d2i3va_

PDB Entry: 2i3v, 2.4 Å

PDB Description: measurement of conformational changes accompanying desensitization in an ionotropic glutamate receptor: structure of g725c mutant

PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d2i3va_:

Sequence; same for both SEQRES and ATOM records:

>d2i3va_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvgcnldskgygiatpkgsslgnavnlavlkln
eqglldklknkwwydkgec

Timeline for d2i3va_:

• d2i3va_ is new in SCOPe 2.01-stable
  
• d2i3va_ appears in SCOPe 2.02
  
• d2i3va_ appears in the current release, SCOPe 2.08