SCOP 1.71: Domain d1watb_: 1wat B:

Lineage for d1watb_ (1wat B:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (24 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.2: Aspartate receptor, ligand-binding domain [47170] (1 family)

5. Family a.24.2.1: Aspartate receptor, ligand-binding domain [47171] (1 protein)

6. Protein Aspartate receptor, ligand-binding domain [47172] (2 species)

7. Species Salmonella typhimurium [TaxId:90371] [47174] (7 PDB entries)

8. Domain d1watb_: 1wat B: [16538]

Details for d1watb_

PDB Entry: 1wat, 3 Å

PDB Description: the three-dimensional structure of the ligand-binding domain of a wild-type bacterial chemotaxis receptor

SCOP Domain Sequences for d1watb_:

Sequence; same for both SEQRES and ATOM records:

>d1watb_ a.24.2.1 (B:) Aspartate receptor, ligand-binding domain {Salmonella typhimurium}
qgfvisnelrqqqseltstwdlmlqtrinlsrsaarmmmdasnqqssaktdllqnakttl
aqaaahyanfknmtplpamaeasanvdekyqryqaalaeliqfldngnmdayfaqptqgm
qnalgealgnyarvsenlyrqtf

Timeline for d1watb_:

• d1watb_ first appeared (with stable ids) in SCOP 1.55
  
• d1watb_ appears in SCOP 1.69
  
• d1watb_ appears in SCOP 1.73
  
• d1watb_ appears in the current release, SCOPe 2.08